PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A01G1281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 477aa    MW: 52795.4 Da    PI: 7.8397
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A01G1281genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.82e-40187264178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +CqvegC+ dls+ak+yhr+h++Ce hsk+p+v+v+g+e+rfCqqCs+fh lsefDe+krsCrrrL++hn+rrrk+q+
  Gh_A01G1281 187 RCQVEGCNFDLSSAKDYHRKHRICESHSKSPKVIVHGQERRFCQQCSKFHGLSEFDEKKRSCRRRLSDHNARRRKPQT 264
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-32184249IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.171185262IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-38186267IPR004333Transcription factor, SBP-box
PfamPF031101.1E-31188261IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MSFISPMDWN AKTPLQWDWE NLMMLNATPT EIPRKLRPEQ WDIDGEGGMN SGSFYSSVAA  60
GGSGGSASDL GLASMSKSSK SASINSSSMG EVKMTKFTSE AFEAIPDDIS NQNEAFRAEL  120
AGTSPTLEAS VGSGEPLLSL KLGKRTYFED VSGGSNTKNL SYSSTSGQSP AQAKRSKPNC  180
QGIHVLRCQV EGCNFDLSSA KDYHRKHRIC ESHSKSPKVI VHGQERRFCQ QCSKFHGLSE  240
FDEKKRSCRR RLSDHNARRR KPQTEAFHFS GTRFSSSPNE GKQQMSFIWN KVPFLHNARP  300
NEIFSWEGTF DSKSSQMKGY TSTKVGNING QPNLPGNELL NSITMRSHDS NGFLPTKGKQ  360
STDDILNQGV EESRVDSNVA TTQDLHRALS LLSNESWVSC EPKHGSIAYP MHVNPSTSMS  420
QPAMNASSRG FPSALSENWQ MEQQTTESQV HNGDGDNHFQ EFQLLKAPYY SGFYSNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-261882611184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243260KKRSCRRRLSDHNARRRK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223100.0KJ622310.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467348.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
RefseqXP_012467349.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
RefseqXP_012467350.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
RefseqXP_012467351.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
RefseqXP_012467352.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
RefseqXP_012467353.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
RefseqXP_012467354.10.0PREDICTED: squamosa promoter-binding-like protein 2 isoform X1
TrEMBLA0A0B0MQX50.0A0A0B0MQX5_G
STRINGVIT_01s0010g03710.t011e-164(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65622644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.33e-81squamosa promoter binding protein-like 2